search in name
search #2 in name
whois status
whois email
min rank
- max rank
max records
chars
registration availability

SELECT * FROM domains WHERE domain_id > 0 AND domain_whois_expiration_date >0 ORDER BY domain_whois_expiration_date desc LIMIT 500
Query time: 0.04 sec

500 results 11289 expire in next 24 hours

fav domain rank whois status email whois expiration avail avail date tools
cuyahogacounty.us 70415 ok espies@cuyahogacounty.us 2038-01-19 3 years ago whois | google
advantageselfstorageonline.com 275176 client transfer prohibited abuse@godaddy.com 2030-01-20 not checked whois | google
zionor.com 429132 ok supervision@xinnet.com 2030-01-20 not checked whois | google
mishikafoods.com 261992 client transfer prohibited abuse-contact@publicdomainregistry.com 2030-01-19 not checked whois | google
stoksatis.com 674793 client transfer prohibited abuse@reg2c.com 2030-01-19 not checked whois | google
sandewildlifecontrol.com 512506 client transfer prohibited abuse@godaddy.com 2030-01-19 12 months ago whois | google
motorcycletraining.com 410066 client transfer prohibited abuse@godaddy.com 2030-01-18 1 year ago whois | google
dermadentclinic.com 356349 client transfer prohibited abuse-contact@publicdomainregistry.com 2030-01-17 not checked whois | google
vavtaksi.com 628195 ok abuse@nicproxy.com 2030-01-17 not checked whois | google
visionict.com 424892 client transfer prohibited 2030-01-16 10 months ago whois | google
ekduran.com 717733 client transfer prohibited abuse@godaddy.com 2030-01-16 not checked whois | google
stoneworksind.com - client transfer prohibited abuse@godaddy.com 2030-01-16 8 months ago whois | google
zumaplast.com 107860 client transfer prohibited abuse-registrar@nordnet.net 2030-01-16 not checked whois | google
triunebjj.com 404138 ok 2030-01-16 not checked whois | google
cmgworldwidefashionweeks.com 599582 client transfer prohibited abuse@web.com 2030-01-15 not checked whois | google
dynamicpoint.com 470371 client transfer prohibited abuse@godaddy.com 2030-01-15 1 year ago whois | google
publicide.com 492670 client transfer prohibited abuse@godaddy.com 2030-01-15 1 year ago whois | google
nifi-is1.com 463003 client transfer prohibited 2030-01-15 not checked whois | google
tekinkece.com 297932 client transfer prohibited 2030-01-15 not checked whois | google
versasafe.com 254489 client transfer prohibited abuse@web.com 2030-01-14 not checked whois | google
presentationzen.com 290012 client transfer prohibited abuse@godaddy.com 2030-01-14 10 months ago whois | google
roycabrera.com 576884 client transfer prohibited abuse@godaddy.com 2030-01-13 not checked whois | google
kislayverma.com 332511 client transfer prohibited abuse-contact@publicdomainregistry.com 2030-01-12 not checked whois | google
mainland.com 405444 client transfer prohibited abuse@web.com 2030-01-12 not checked whois | google
jandsmfg.com 574491 client transfer prohibited abuse@web.com 2030-01-11 not checked whois | google
ncsoftware.com 259965 client transfer prohibited abuse@web.com 2030-01-11 not checked whois | google
samuelbetio.com 798518 client transfer prohibited abuse@web.com 2030-01-10 not checked whois | google
allterrasolar.com 440116 client transfer prohibited abuse@namecheap.com 2030-01-09 1 year ago whois | google
camasirlik.com 304211 ok abuse@nicproxy.com 2030-01-09 not checked whois | google
swankysocks.com 343247 ok abuse@crazydomains.com 2030-01-09 11 months ago whois | google
suseefinance.com 467247 client transfer prohibited abuse@web.com 2030-01-09 not checked whois | google
nafiducia.com 762829 client transfer prohibited abuse-contact@publicdomainregistry.com 2030-01-08 not checked whois | google
sleepydonut.com 551947 client transfer prohibited abuse@namecheap.com 2030-01-08 not checked whois | google
busrates.com 475422 client transfer prohibited abuse@godaddy.com 2030-01-08 10 months ago whois | google
foothillcyclery.com 199385 client transfer prohibited abuse@godaddy.com 2030-01-07 not checked whois | google
dadofdivas.com 390063 ok abuse@godaddy.com 2030-01-07 not checked whois | google
twdaz.com 379646 client transfer prohibited abuse@godaddy.com 2030-01-07 8 months ago whois | google
hautelookcdn.com 285553 client transfer prohibited abuse@godaddy.com 2030-01-07 not checked whois | google
sworganizing.com - client transfer prohibited abuse@godaddy.com 2030-01-07 9 months ago whois | google
edarookhane.com 373826 client transfer prohibited compliance_abuse@webnic.cc 2030-01-07 not checked whois | google
ynle.com - client transfer prohibited abuse@godaddy.com 2030-01-07 3 years ago whois | google
originam.com 844399 client transfer prohibited abuse@godaddy.com 2030-01-06 1 year ago whois | google
selecttrees.com 198208 client transfer prohibited abuse@web.com 2030-01-06 not checked whois | google
glgoodbaby.com 313393 client transfer prohibited supervision@xinnet.com 2030-01-06 3 years ago whois | google
dogtalesdaycare.com 391724 ok abuse@web.com 2030-01-05 not checked whois | google
ibjja.com 180561 client transfer prohibited abuse@godaddy.com 2030-01-05 1 year ago whois | google
truthbecomesher.com 185473 client transfer prohibited abuse@godaddy.com 2030-01-05 not checked whois | google
savingshippo.com 335214 client transfer prohibited abuse@namecheap.com 2030-01-05 not checked whois | google
scottfarms.com 500938 client transfer prohibited abuse@web.com 2030-01-04 not checked whois | google
christopherschaefer.com - client transfer prohibited abuse@godaddy.com 2030-01-04 1 year ago whois | google
nol-insaat.com 735531 client transfer prohibited rtr-security-threats@realtimeregister.com 2030-01-04 not checked whois | google
saradayani.com 563612 client transfer prohibited abuse@godaddy.com 2030-01-04 not checked whois | google
kgb-productions.com 316124 client transfer prohibited abuse@web.com 2030-01-03 not checked whois | google
freedonationz.com 473107 client transfer prohibited abuse@web.com 2030-01-03 not checked whois | google
paradeofquartets.com 416564 client transfer prohibited abuse@godaddy.com 2030-01-03 not checked whois | google
mlsteel.com 475363 client transfer prohibited abuse@godaddy.com 2030-01-03 not checked whois | google
abexch9.com 323142 client transfer prohibited abuse@godaddy.com 2030-01-03 not checked whois | google
globestar.com 601382 client transfer prohibited abuse@web.com 2030-01-03 not checked whois | google
livfreeyogaschool.com 275917 client transfer prohibited abuse@godaddy.com 2030-01-02 not checked whois | google
niagahoster.com 190975 client transfer prohibited abuse@hostinger.com 2030-01-02 not checked whois | google
petshopalomama.com 626858 ok abuse@nicproxy.com 2030-01-02 not checked whois | google
bvwschool.com 120251 client transfer prohibited abuse@godaddy.com 2030-01-02 not checked whois | google
bookhams.com - client transfer prohibited abuse@register.it 2030-01-02 11 months ago whois | google
openprints.com 311275 client transfer prohibited abuse@godaddy.com 2030-01-02 1 year ago whois | google
forextradings.com 635119 client transfer prohibited abuse-contact@publicdomainregistry.com 2030-01-02 not checked whois | google
aflalo.com 282764 client transfer prohibited abuse@godaddy.com 2030-01-02 not checked whois | google
johnpetitto.com - client transfer prohibited abuse@godaddy.com 2030-01-01 11 months ago whois | google
gmz100.com 50764 ok domain@cndns.com 2030-01-01 not checked whois | google
brittwooddesigns.com 388157 client transfer prohibited abuse@web.com 2029-12-31 not checked whois | google
beadkit.com 353685 client transfer prohibited abuse@web.com 2029-12-31 not checked whois | google
cotereco.com 328165 client transfer prohibited abuse@web.com 2029-12-31 not checked whois | google
jybaguazang.com 235853 client transfer prohibited abuse@godaddy.com 2029-12-31 not checked whois | google
behsagold.com 531566 client transfer prohibited abuse@joker.com 2029-12-30 not checked whois | google
jmamsoftware.com 547244 client transfer prohibited abuse@godaddy.com 2029-12-30 not checked whois | google
repriceit.com 148923 client transfer prohibited dns@cs.aplus.net 2029-12-30 11 months ago whois | google
projectcamelotportal.com 165365 client transfer prohibited abuse@godaddy.com 2029-12-29 11 months ago whois | google
illogisticsinc.com 183487 client transfer prohibited 2029-12-29 not checked whois | google
is-dl.com 376348 client transfer prohibited abuse@godaddy.com 2029-12-28 not checked whois | google
mlmfoto.com 650900 ok abuse-contact@publicdomainregistry.com 2029-12-28 11 months ago whois | google
corporategurukul.com 338854 ok abuse-contact@publicdomainregistry.com 2029-12-28 1 year ago whois | google
getmedtour.com 246710 client transfer prohibited abuse@namecheap.com 2029-12-28 not checked whois | google
4wdstudio.com 286852 client transfer prohibited abuse@godaddy.com 2029-12-27 not checked whois | google
betrabio.com 488584 client transfer prohibited 2029-12-27 not checked whois | google
mania4tech.com 414857 client transfer prohibited abuse@namecheap.com 2029-12-27 not checked whois | google
woodyinvestments.com 272893 client transfer prohibited 2029-12-26 not checked whois | google
winnebago.com 178560 client transfer prohibited abuse@web.com 2029-12-26 not checked whois | google
alanzang.com 373175 ok DomainAbuse@service.aliyun.com 2029-12-25 not checked whois | google
eurekaeatery.com 393149 client transfer prohibited abuse@godaddy.com 2029-12-24 not checked whois | google
bluerushservices.com 173624 client transfer prohibited abuse@godaddy.com 2029-12-24 not checked whois | google
schupbachsales.com - client transfer prohibited 2029-12-24 1 year ago whois | google
maxtalk.com 459157 client transfer prohibited 2029-12-23 not checked whois | google
peppermooncatering.com 191251 client transfer prohibited abuse@godaddy.com 2029-12-23 1 year ago whois | google
vetermusic.com 782342 client transfer prohibited abuse@godaddy.com 2029-12-23 not checked whois | google
zhidaip.com - ok abuse@dnspod.com 2029-12-23 6 months ago whois | google
ikikatadojo.com 77329 client transfer prohibited abuse@namecheap.com 2029-12-23 not checked whois | google
18kinero.com 36329 client transfer prohibited 2029-12-22 not checked whois | google
tlcintime.com 295991 client transfer prohibited abuse@godaddy.com 2029-12-22 not checked whois | google
alcosecu.com 315978 client transfer prohibited dns@cs.aplus.net 2029-12-22 9 months ago whois | google
colorconstancy.com 801806 client transfer prohibited 2029-12-22 not checked whois | google
ranotech.com 572264 client transfer prohibited abuse@wildwestdomains.com 2029-12-22 1 year ago whois | google
redrover.com 499293 client transfer prohibited abuse@web.com 2029-12-22 not checked whois | google
laemthongfood.com 648897 client transfer prohibited abuse@web.com 2029-12-22 not checked whois | google
latintouchagency.com 392657 client transfer prohibited abuse@namecheap.com 2029-12-21 not checked whois | google
reshamwalashipbrokers.com 353091 client transfer prohibited abuse@web.com 2029-12-21 not checked whois | google
poebuki.com 79494 client transfer prohibited 2029-12-21 not checked whois | google
turklersemsiye.com 618961 ok abuse@nicproxy.com 2029-12-20 not checked whois | google
juliakennedy.com - client transfer prohibited 2029-12-20 1 year ago whois | google
hentatsu.com 75399 ok abuse@gmo.jp 2029-12-20 not checked whois | google
vietadiag.com 595951 client transfer prohibited abuse@pavietnam.vn 2029-12-20 not checked whois | google
transammonia.com 401454 client transfer prohibited abuse@web.com 2029-12-20 not checked whois | google
kurdi.com 498919 client transfer prohibited abuse@web.com 2029-12-20 not checked whois | google
adamdavidson.com 527032 client transfer prohibited abuse@web.com 2029-12-19 not checked whois | google
myfastship.com 166824 client transfer prohibited abuse@godaddy.com 2029-12-19 not checked whois | google
ethanhamrick.com 366716 client transfer prohibited 2029-12-18 not checked whois | google
medstep.com 469166 client transfer prohibited registrar-abuse@google.com 2029-12-18 not checked whois | google
projectedscenery.com 432890 client transfer prohibited abuse@web.com 2029-12-17 not checked whois | google
franchiseworldreview.com 286583 client transfer prohibited abuse@godaddy.com 2029-12-17 not checked whois | google
thefranchiseworldreview.com 426388 client transfer prohibited abuse@godaddy.com 2029-12-17 not checked whois | google
resacamarket.com 415636 client transfer prohibited abuse@godaddy.com 2029-12-17 not checked whois | google
hartlaw.com 474639 client transfer prohibited abuse@web.com 2029-12-17 not checked whois | google
mainichi-emiyagohan.com 249437 ok abuse@gmo.jp 2029-12-17 not checked whois | google
enjoyturquia.com 463539 client transfer prohibited abuse@godaddy.com 2029-12-16 not checked whois | google
copac.com 326836 client transfer prohibited abuse@web.com 2029-12-16 not checked whois | google
vallonindustries.com 585106 client transfer prohibited abuse@namecheap.com 2029-12-15 not checked whois | google
cashonlinenetwork.com 236704 client transfer prohibited abuse@godaddy.com 2029-12-15 not checked whois | google
verawolf.com 667351 client transfer prohibited abuse@web.com 2029-12-14 not checked whois | google
safelockstorage.com 353418 ok abuse@web.com 2029-12-14 not checked whois | google
bec-memphis.com 277795 client transfer prohibited abuse@web.com 2029-12-13 not checked whois | google
goldengooserumson.com 133615 client transfer prohibited abuse@godaddy.com 2029-12-13 not checked whois | google
fantasycordis.com 358921 client transfer prohibited abuse@godaddy.com 2029-12-13 not checked whois | google
thesandboxchicago.com 445965 client transfer prohibited 2029-12-12 not checked whois | google
gigfasteruniversity.com 193910 client transfer prohibited abuse@godaddy.com 2029-12-12 not checked whois | google
gcroofing.com 384663 client transfer prohibited abuse@godaddy.com 2029-12-12 8 months ago whois | google
eriegoldandsilver.com 284498 client transfer prohibited abuse@web.com 2029-12-12 not checked whois | google
deobag.com - client transfer prohibited abuse@godaddy.com 2029-12-12 10 months ago whois | google
neyiyok.com 610660 ok abuse@nicproxy.com 2029-12-12 not checked whois | google
hmpathome.com 294971 client transfer prohibited abuse@web.com 2029-12-11 not checked whois | google
p3-i.com 266471 client transfer prohibited abuse@porkbun.com 2029-12-11 not checked whois | google
homeover.com 352719 client transfer prohibited dns@cs.aplus.net 2029-12-11 1 year ago whois | google
myrtomiliou.com 453789 client transfer prohibited abuse@web.com 2029-12-10 not checked whois | google
usadosmultimarca.com 278822 client transfer prohibited abuse@godaddy.com 2029-12-10 not checked whois | google
pnc-qa.com 242824 client transfer prohibited domainabuse@cscglobal.com 2029-12-10 not checked whois | google
shahincon.com 283601 client transfer prohibited abuse@godaddy.com 2029-12-10 not checked whois | google
abodetidings.com 460331 ok abuse-contact@publicdomainregistry.com 2029-12-10 not checked whois | google
mqb-cpa.com 276432 client transfer prohibited abuse@web.com 2029-12-10 not checked whois | google
boorom.com 480184 client transfer prohibited abuse@web.com 2029-12-10 not checked whois | google
superangels.com 460223 client transfer prohibited abuse@dynadot.com 2029-12-09 not checked whois | google
wottoart.com - client transfer prohibited abuse@godaddy.com 2029-12-09 1 year ago whois | google
palmbeachresearch.com 401177 client transfer prohibited abuse@web.com 2029-12-09 not checked whois | google
roseacredental.com 772261 client transfer prohibited abuse@web.com 2029-12-09 not checked whois | google
tridentprocess.com 281296 client transfer prohibited abuse@web.com 2029-12-09 not checked whois | google
mdgamerica.com 410494 client transfer prohibited abuse@web.com 2029-12-08 not checked whois | google
farmingtonlittleleague.com 365743 client transfer prohibited abuse@godaddy.com 2029-12-08 not checked whois | google
honeygains.com 404651 client transfer prohibited abuse@godaddy.com 2029-12-08 not checked whois | google
two-cylinder.com 321201 client transfer prohibited abuse@web.com 2029-12-08 not checked whois | google
sturgeonventures.com 685412 client transfer prohibited 2029-12-07 not checked whois | google
marylandparkbicycles.com - client transfer prohibited abuse@godaddy.com 2029-12-07 12 months ago whois | google
keypackaging.com 574186 client transfer prohibited abuse@web.com 2029-12-07 not checked whois | google
zappobz.com 178649 client transfer prohibited abuse@web.com 2029-12-06 not checked whois | google
loomah.com 141580 client transfer prohibited 2029-12-06 not checked whois | google
tranetechnologies.com 333920 ok 2029-12-06 not checked whois | google
play88go.com 292687 client transfer prohibited compliance_abuse@webnic.cc 2029-12-06 not checked whois | google
melonbots.com 474901 client transfer prohibited abuse@godaddy.com 2029-12-06 not checked whois | google
masters-school.com 259691 client transfer prohibited abuse@web.com 2029-12-06 not checked whois | google
lerelaisdumiel.com - client transfer prohibited abuse-registrar@nordnet.net 2029-12-06 1 year ago whois | google
rmram.com 346597 client transfer prohibited abuse@godaddy.com 2029-12-05 not checked whois | google
germaniaamp.com 316705 client transfer prohibited abuse@namecheap.com 2029-12-05 not checked whois | google
whisperingpines.com 485961 client transfer prohibited abuse@web.com 2029-12-05 not checked whois | google
hairqueenexpress.com 297546 client transfer prohibited abuse@godaddy.com 2029-12-05 not checked whois | google
ace4surplus.com 472238 client transfer prohibited abuse@web.com 2029-12-04 not checked whois | google
grovesconstruction.com 434437 client transfer prohibited abuse@web.com 2029-12-04 not checked whois | google
christmasthenandnow.com 189664 client transfer prohibited abuse@godaddy.com 2029-12-04 not checked whois | google
ojmannelectric.com 410925 client transfer prohibited abuse@web.com 2029-12-04 not checked whois | google
kuaforuz.com 716613 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-12-04 not checked whois | google
weilongzhang.com 529028 client transfer prohibited abuse@web.com 2029-12-04 not checked whois | google
globalhtf.com 705950 client transfer prohibited 2029-12-04 1 year ago whois | google
rlhellwig.com 389449 client transfer prohibited abuse@web.com 2029-12-04 not checked whois | google
7e.com 538070 client transfer prohibited abuse@web.com 2029-12-04 not checked whois | google
latcrosswordanswers.com 176612 client transfer prohibited abuse@namecheap.com 2029-12-04 not checked whois | google
manocoupon.com 705084 client transfer prohibited abuse@namecheap.com 2029-12-03 not checked whois | google
pryorpediatricdentistry.com 417676 client transfer prohibited abuse@web.com 2029-12-03 not checked whois | google
cfosm.com 350965 client transfer prohibited abuse@web.com 2029-12-03 not checked whois | google
vixo.com - client transfer prohibited 2029-12-03 1 year ago whois | google
fritinc.com 394844 client transfer prohibited abuse@web.com 2029-12-03 not checked whois | google
wascofastpitch.com 240533 client transfer prohibited abuse@web.com 2029-12-03 not checked whois | google
rostare.com 586928 client transfer prohibited abuse@godaddy.com 2029-12-03 not checked whois | google
onestopcustom.com - ok 2029-12-02 12 months ago whois | google
jmin-iplaw.com 685857 client transfer prohibited abuse@godaddy.com 2029-12-02 not checked whois | google
fastfuture.com 521935 ok 2029-12-02 not checked whois | google
wayneandersbeachagent.com 500594 client transfer prohibited abuse@web.com 2029-12-02 not checked whois | google
orlandohotyoga.com 236319 client transfer prohibited abuse@godaddy.com 2029-12-02 not checked whois | google
bisorun.com 673926 ok abuse@domaintime.biz 2029-12-02 not checked whois | google
blackdogtherapy.com - client transfer prohibited abuse@register.it 2029-12-02 8 months ago whois | google
socksstores.com 364329 ok abuse@nicproxy.com 2029-12-02 not checked whois | google
bioplus-sport.com 340327 client transfer prohibited abuse@godaddy.com 2029-12-02 not checked whois | google
lumistraw.com 303255 ok abuse@crazydomains.com 2029-12-02 not checked whois | google
osesemi.com - client transfer prohibited supervision@xinnet.com 2029-12-02 1 year ago whois | google
builtbetter.com 279533 ok abuse@web.com 2029-12-01 not checked whois | google
ivonnehernandez.com 229212 client transfer prohibited abuse@namejuice.com 2029-12-01 not checked whois | google
muytacos.com 758516 client transfer prohibited abuse@web.com 2029-12-01 not checked whois | google
dobuya.com - ok abuse@55hl.com 2029-12-01 6 days ago whois | google
airservicesaustralia.com 374466 client transfer prohibited abuse@melbourneit.com.au 2029-12-01 not checked whois | google
yuadon.com - client transfer prohibited DomainAbuse@service.aliyun.com 2029-12-01 3 years ago whois | google
chinaztg.com 22999 ok DomainAbuse@service.aliyun.com 2029-12-01 not checked whois | google
locksdaily.com 299318 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-12-01 not checked whois | google
maresupply.com 683526 client transfer prohibited abuse@gkg.net 2029-11-30 not checked whois | google
photographicsphoto.com 335433 client transfer prohibited abuse@godaddy.com 2029-11-30 not checked whois | google
cityofcrystalsprings.com - client transfer prohibited abuse@godaddy.com 2029-11-30 1 year ago whois | google
truck-insure.com 429305 client transfer prohibited abusecomplaints@markmonitor.com 2029-11-30 not checked whois | google
hirdavolt.com 731097 client transfer prohibited 2029-11-30 not checked whois | google
prayconstruction.com 578536 client transfer prohibited abuse@web.com 2029-11-30 not checked whois | google
sigcap.com 352527 client transfer prohibited abuse@web.com 2029-11-30 not checked whois | google
onetravel-eg.com 569621 client transfer prohibited abuse@namecheap.com 2029-11-29 not checked whois | google
whdentistry.com 321123 client transfer prohibited abuse@godaddy.com 2029-11-29 not checked whois | google
outletdogoleiro.com 538272 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-29 1 year ago whois | google
namsanambalaj.com 643672 client transfer prohibited 2029-11-29 not checked whois | google
bouiblane.com 231706 client transfer prohibited abuse@namecheap.com 2029-11-28 not checked whois | google
tobobg.com 136473 client transfer prohibited 2029-11-28 not checked whois | google
wildanimalexpeditions.com 510387 client transfer prohibited abuse@domainit.com 2029-11-28 not checked whois | google
starsegy.com 408127 client transfer prohibited abuse@godaddy.com 2029-11-27 not checked whois | google
depositlink.com 360536 client transfer prohibited abuse@godaddy.com 2029-11-27 not checked whois | google
zmncollection.com 596424 client transfer prohibited 2029-11-27 not checked whois | google
notforcreatives.com 505046 client transfer prohibited abuse@godaddy.com 2029-11-27 not checked whois | google
ngfeeds.com - client transfer prohibited abuse@godaddy.com 2029-11-27 1 year ago whois | google
dalefranks.com 454258 client transfer prohibited abuse@web.com 2029-11-27 not checked whois | google
scc777.com 606303 client transfer prohibited abuse@dynadot.com 2029-11-26 not checked whois | google
johnscateringny.com 364044 client transfer prohibited abuse@godaddy.com 2029-11-26 not checked whois | google
blackwolfrental.com 361450 client transfer prohibited abuse@godaddy.com 2029-11-26 not checked whois | google
hediyenizvar.com 716244 client transfer prohibited abuse@godaddy.com 2029-11-26 not checked whois | google
oltayagel.com 385733 ok 2029-11-26 1 year ago whois | google
indomemotors.com 381581 client transfer prohibited abuse@namecheap.com 2029-11-26 not checked whois | google
techstrait.com 496764 client transfer prohibited abuse@web.com 2029-11-26 not checked whois | google
imssvs.com 520780 client transfer prohibited abuse@web.com 2029-11-26 not checked whois | google
nashautousa.com 149376 client transfer prohibited abuse@godaddy.com 2029-11-25 not checked whois | google
mountauburndental.com 459381 client transfer prohibited abuse@godaddy.com 2029-11-25 not checked whois | google
istanbulfilmawards.com 680028 client transfer prohibited abuse@godaddy.com 2029-11-25 not checked whois | google
havintextile.com 609604 client transfer prohibited abuse@onlinenic.com 2029-11-25 not checked whois | google
thesalesgroup.com 297334 client transfer prohibited abuse@web.com 2029-11-25 not checked whois | google
steelwings.com 213174 client transfer prohibited abuse@web.com 2029-11-25 not checked whois | google
minterdial.com 148043 client transfer prohibited abuse@godaddy.com 2029-11-24 1 year ago whois | google
silvasfinancialservices.com 288935 client transfer prohibited abuse@godaddy.com 2029-11-24 not checked whois | google
lovecrafttattoo.com - ok 2029-11-24 1 year ago whois | google
mbifinancial.com 284460 client transfer prohibited abuse@webnames.ca 2029-11-24 not checked whois | google
hmadesign.com 503665 client transfer prohibited compliance_abuse@webnic.cc 2029-11-24 1 year ago whois | google
dobsystems.com 624869 client transfer prohibited abuse@web.com 2029-11-24 not checked whois | google
coexgroup.com 586497 client transfer prohibited abuse@web.com 2029-11-24 not checked whois | google
shopwithyourdealishere.com 193051 client transfer prohibited abuse@namecheap.com 2029-11-24 not checked whois | google
shalomandsons.com 391387 client transfer prohibited abuse@web.com 2029-11-23 not checked whois | google
envoymedical.com 303123 client transfer prohibited abuse@web.com 2029-11-23 not checked whois | google
paikids.com 207960 client transfer prohibited abuse@web.com 2029-11-23 not checked whois | google
proeze.com 252232 client transfer prohibited abuse@godaddy.com 2029-11-23 not checked whois | google
tashin.com 362228 client transfer prohibited abuse@web.com 2029-11-23 not checked whois | google
marcovi.com 534083 client transfer prohibited abuse@web.com 2029-11-23 not checked whois | google
gigamonkeys.com 189266 client transfer prohibited abuse@namecheap.com 2029-11-23 not checked whois | google
toyotachiangrai.com 637944 client transfer prohibited abuse@name.com 2029-11-23 not checked whois | google
myphiladelphiastory.com 149815 client transfer prohibited abuse@web.com 2029-11-23 not checked whois | google
ozmail.com 342999 client transfer prohibited abuse@godaddy.com 2029-11-22 not checked whois | google
catroullette.com 268717 client transfer prohibited abuse@godaddy.com 2029-11-22 not checked whois | google
apohair.com 569240 client transfer prohibited abuse@matbao.com 2029-11-22 11 months ago whois | google
stuartweb.com 241529 client transfer prohibited abuse@web.com 2029-11-22 not checked whois | google
metodox-brain.com 169893 client transfer prohibited abuse@godaddy.com 2029-11-22 not checked whois | google
fadesquares.com 331146 client transfer prohibited abuse@godaddy.com 2029-11-22 not checked whois | google
pefbazaar.com 574116 client transfer prohibited abuse@namecheap.com 2029-11-21 not checked whois | google
gideonhvac.com 399890 client transfer prohibited abuse@godaddy.com 2029-11-21 not checked whois | google
idealpak.com 568879 ok DomainAbuse@service.aliyun.com 2029-11-21 not checked whois | google
doplan.com 337939 client transfer prohibited abuse@web.com 2029-11-21 not checked whois | google
roseandassociates.com 265012 client transfer prohibited abuse@web.com 2029-11-20 not checked whois | google
danceu2.com 230349 client transfer prohibited abuse@web.com 2029-11-20 not checked whois | google
nlamsterdamhotel.com 598093 ok abuse@domaintime.biz 2029-11-20 not checked whois | google
printmate.com 479918 client transfer prohibited abuse@web.com 2029-11-20 not checked whois | google
fairman-consulting.com - client transfer prohibited abuse@bookmyname.com 2029-11-20 1 year ago whois | google
echamat-kernst.com - ok abuse-registrar@nordnet.net 2029-11-20 1 year ago whois | google
valentinesinniagara.com 214283 client transfer prohibited abuse@godaddy.com 2029-11-20 not checked whois | google
peerlesscleaners.com 312303 ok abuse@web.com 2029-11-20 not checked whois | google
mayhai.com 373553 client transfer prohibited abuse@pavietnam.vn 2029-11-20 not checked whois | google
trcustominc.com 437811 client transfer prohibited abuse@godaddy.com 2029-11-20 not checked whois | google
nickbarber.com - client transfer prohibited registrar-abuse@google.com 2029-11-20 10 months ago whois | google
seankcollinslaw.com 225521 client transfer prohibited abuse@godaddy.com 2029-11-19 not checked whois | google
pcgcontracting.com 499829 client transfer prohibited abuse@wildwestdomains.com 2029-11-19 not checked whois | google
gregoreki.com 741936 client transfer prohibited abuse@godaddy.com 2029-11-19 not checked whois | google
kaplanfersah.com 488004 ok abuse@domaintime.biz 2029-11-19 not checked whois | google
tayfx.com 728785 ok abuse@nicproxy.com 2029-11-19 not checked whois | google
zelorie.com 193310 client transfer prohibited abuse@godaddy.com 2029-11-19 not checked whois | google
cognitivebehaviouralcoachingworks.com 561959 client transfer prohibited 2029-11-19 1 year ago whois | google
olvin.com 430782 client transfer prohibited abuse@godaddy.com 2029-11-19 1 year ago whois | google
heritage66.com 518592 client transfer prohibited abuse@godaddy.com 2029-11-19 not checked whois | google
escueladeneurocienciasaplicadas.com 172653 client transfer prohibited abuse@godaddy.com 2029-11-19 not checked whois | google
5focus.com 232907 ok 2029-11-19 not checked whois | google
exumacarrental.com 354495 client transfer prohibited abuse@web.com 2029-11-18 not checked whois | google
criminaldefenselawyervirginia.com 698113 client transfer prohibited abuse@godaddy.com 2029-11-18 not checked whois | google
jhaladjian.com 540336 client transfer prohibited abuse@godaddy.com 2029-11-18 not checked whois | google
techlabrepairs.com 264221 client transfer prohibited abuse@godaddy.com 2029-11-18 not checked whois | google
ndegenkolb.com 520524 client transfer prohibited abuse@godaddy.com 2029-11-18 not checked whois | google
labelleprovince.com 459327 client transfer prohibited abuse@web.com 2029-11-18 not checked whois | google
stemmerich.com 436487 client transfer prohibited abuse@web.com 2029-11-18 not checked whois | google
pk-research.com 519240 client transfer prohibited abuse@web.com 2029-11-18 not checked whois | google
ktguesthouse.com 608153 client transfer prohibited abuse@web.com 2029-11-18 not checked whois | google
ledouxinsurance.com 259376 client transfer prohibited abuse@web.com 2029-11-17 not checked whois | google
entrecotesaintjean.com 347464 client transfer prohibited abuse@web.com 2029-11-17 not checked whois | google
bankofhancock.com 385655 client transfer prohibited abuse@web.com 2029-11-17 not checked whois | google
micra.com 609750 client transfer prohibited abuse@web.com 2029-11-17 not checked whois | google
maros.com 610684 client transfer prohibited abuse@web.com 2029-11-17 not checked whois | google
alhambrapalacechicago.com 312759 client transfer prohibited abuse@godaddy.com 2029-11-17 not checked whois | google
gobeyondbones.com 611723 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-17 not checked whois | google
yatko.com 243825 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-16 1 year ago whois | google
chemlogix.com 357371 client transfer prohibited abuse@web.com 2029-11-16 not checked whois | google
glicklaw.com 461824 client transfer prohibited abuse@web.com 2029-11-16 not checked whois | google
rt34landscape.com 267697 client transfer prohibited abuse@web.com 2029-11-15 not checked whois | google
kordeaux.com 317618 client transfer prohibited abuse@namesilo.com 2029-11-15 not checked whois | google
commercialsheetmetalsystems.com 305085 client transfer prohibited abuse@godaddy.com 2029-11-15 not checked whois | google
cheshiremoonproductions.com 501161 client transfer prohibited abuse@godaddy.com 2029-11-15 not checked whois | google
fabiofischer.com 718559 ok abuse@nicproxy.com 2029-11-15 not checked whois | google
kayamasalitravelagency.com 744284 client transfer prohibited 2029-11-15 not checked whois | google
kogans.com 342414 client transfer prohibited abuse@web.com 2029-11-15 not checked whois | google
guitar-stool.com - client transfer prohibited 2029-11-15 1 year ago whois | google
cybertrk.com 560844 client transfer prohibited abuse@godaddy.com 2029-11-14 not checked whois | google
brookfieldservice.com 373391 client transfer prohibited abuse@web.com 2029-11-14 not checked whois | google
dressitupprombridal.com 391302 client transfer prohibited abuse@godaddy.com 2029-11-14 not checked whois | google
hotelprincipadodurango.com - ok abuse-contact@publicdomainregistry.com 2029-11-14 10 months ago whois | google
neugeneinternational.com 478045 client transfer prohibited abuse@godaddy.com 2029-11-14 not checked whois | google
shanthihotel.com 338403 client transfer prohibited abuse@godaddy.com 2029-11-14 not checked whois | google
iqwings.com - client transfer prohibited abuse@godaddy.com 2029-11-14 1 year ago whois | google
bangumi.com 50168 client transfer prohibited 2029-11-14 not checked whois | google
alaskaadventureconcierge.com 260922 client transfer prohibited abuse@godaddy.com 2029-11-13 not checked whois | google
transporteknotfest.com 354105 client transfer prohibited 2029-11-13 not checked whois | google
studentsprinting.com 327356 client transfer prohibited abuse@godaddy.com 2029-11-13 not checked whois | google
ukrtower.com 745073 client transfer prohibited abuse@godaddy.com 2029-11-13 not checked whois | google
ijmtoyota.com 480878 client transfer prohibited abuse@godaddy.com 2029-11-13 not checked whois | google
noimpos.com 266008 client transfer prohibited abuse@godaddy.com 2029-11-13 not checked whois | google
somideephealthcare.com 437018 client transfer prohibited abuse@godaddy.com 2029-11-13 not checked whois | google
aktive.com 204602 client transfer prohibited abuse@web.com 2029-11-13 not checked whois | google
marcus-ng.com 576626 client transfer prohibited abuse@godaddy.com 2029-11-13 not checked whois | google
skheme.com 449703 client transfer prohibited abuse@melbourneit.com.au 2029-11-12 12 months ago whois | google
westbrooktowers.com 491750 client transfer prohibited abuse@web.com 2029-11-12 not checked whois | google
endurancebin.com 396399 client transfer prohibited 2029-11-12 12 months ago whois | google
hotelamigrace.com 302868 client transfer prohibited abuse@godaddy.com 2029-11-12 not checked whois | google
balonagahi.com 192046 ok 2029-11-12 not checked whois | google
odevzamani.com 468727 ok abuse@domaintime.biz 2029-11-12 not checked whois | google
gooseriverbank.com - client transfer prohibited abuse@godaddy.com 2029-11-12 1 year ago whois | google
worthlessafc.com 515595 client transfer prohibited abuse@web.com 2029-11-11 not checked whois | google
srglobalmy.com 566446 client transfer prohibited abuse@godaddy.com 2029-11-11 not checked whois | google
srglobalus.com 241387 client transfer prohibited abuse@godaddy.com 2029-11-11 not checked whois | google
wailuarivernoni.com 499175 client transfer prohibited abuse@godaddy.com 2029-11-11 not checked whois | google
actschb.com 744803 client transfer prohibited abuse@web.com 2029-11-10 not checked whois | google
demode.com 731271 client transfer prohibited abuse@web.com 2029-11-10 not checked whois | google
orangecountytranslations.com 426572 client transfer prohibited abuse@namecheap.com 2029-11-10 not checked whois | google
zackcotton.com 333568 client transfer prohibited abuse@namecheap.com 2029-11-10 not checked whois | google
seebald.com 418154 client transfer prohibited abuse@web.com 2029-11-10 not checked whois | google
nmanikiran.com 487465 client transfer prohibited abuse@porkbun.com 2029-11-10 not checked whois | google
modelelectric.com 524961 client transfer prohibited abuse@web.com 2029-11-10 not checked whois | google
lhlacy.com 500455 client transfer prohibited abuse@web.com 2029-11-10 not checked whois | google
huynhphuchuy.com 466737 client transfer prohibited abuse@godaddy.com 2029-11-10 not checked whois | google
faithandfuntours.com 331589 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-10 not checked whois | google
compuproof.com 444564 ok dns@cs.aplus.net 2029-11-09 not checked whois | google
mt-sir.com 432919 client transfer prohibited abuse@dynadot.com 2029-11-09 not checked whois | google
conleyandpartners.com 274195 client transfer prohibited abuse@godaddy.com 2029-11-09 not checked whois | google
ozturkfashion.com 748027 client transfer prohibited abuse@namecheap.com 2029-11-09 not checked whois | google
greenfieldmortgages.com 415256 ok 2029-11-09 not checked whois | google
sejoursanglaisenormandie.com 440952 client transfer prohibited 2029-11-09 not checked whois | google
kenlockqhranch.com 384758 ok abuse@crazydomains.com 2029-11-09 not checked whois | google
plumberbathware.com 419715 client transfer prohibited abuse@godaddy.com 2029-11-09 not checked whois | google
ehelper.com 325334 client transfer prohibited abuse@web.com 2029-11-09 not checked whois | google
2share.com 539663 client transfer prohibited abuse@web.com 2029-11-09 not checked whois | google
pacealliance.com 252771 client transfer prohibited abuse@web.com 2029-11-08 not checked whois | google
bondedtransportation.com 359836 client transfer prohibited abuse@web.com 2029-11-08 not checked whois | google
twosherpas.com 319107 client transfer prohibited abuse@web.com 2029-11-08 not checked whois | google
lauriebuchanan.com 308988 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-08 not checked whois | google
ejristos.com 441165 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-08 not checked whois | google
greenhilljewelers.com 330571 client transfer prohibited abuse@web.com 2029-11-08 not checked whois | google
smtkait.com 154180 ok DomainAbuse@service.aliyun.com 2029-11-08 not checked whois | google
robotzone.com 532807 client transfer prohibited abuse@web.com 2029-11-08 not checked whois | google
themadisontheatre.com 223088 client transfer prohibited abuse@godaddy.com 2029-11-07 not checked whois | google
visacourierservices.com 390363 client transfer prohibited abuse@godaddy.com 2029-11-07 not checked whois | google
edmontonvisioncentre.com 403850 client transfer prohibited abuse@web.com 2029-11-07 not checked whois | google
appliancegenie.com 688495 client transfer prohibited 2029-11-07 not checked whois | google
igdb.com 64801 client transfer prohibited abusecomplaints@markmonitor.com 2029-11-07 3 years ago whois | google
fireandwaterdamagenearmehouston.com 466090 client transfer prohibited abuse@name.com 2029-11-07 not checked whois | google
wecre8websites.com 323219 client transfer prohibited abuse@namecheap.com 2029-11-07 not checked whois | google
delawareshoreproperties.com 326749 client transfer prohibited abuse@web.com 2029-11-07 not checked whois | google
aavularealestate.com 451542 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-07 not checked whois | google
meals50.com 482452 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-07 not checked whois | google
boyetteanimalhospital.com 184904 client transfer prohibited abuse@web.com 2029-11-07 not checked whois | google
reelmensucat.com 422582 client transfer prohibited 2029-11-07 not checked whois | google
firebird-group.com 543524 client transfer prohibited abuse@godaddy.com 2029-11-07 not checked whois | google
marquis-fx.com 379296 client transfer prohibited abuse@godaddy.com 2029-11-07 not checked whois | google
jonathanrenshon.com 758055 client transfer prohibited abuse@godaddy.com 2029-11-07 not checked whois | google
reduxdefinition.com 312325 client transfer prohibited 2029-11-07 not checked whois | google
roeserhomes.com - client transfer prohibited abuse@melbourneit.com.au 2029-11-06 11 months ago whois | google
zskpc.com 429827 client transfer prohibited abuse@godaddy.com 2029-11-06 not checked whois | google
seyhangold.com 707245 client transfer prohibited abuse@godaddy.com 2029-11-06 not checked whois | google
shubhadish.com 491110 client transfer prohibited abuse@godaddy.com 2029-11-06 not checked whois | google
zealyi.com 46891 ok DomainAbuse@service.aliyun.com 2029-11-06 not checked whois | google
carlsonbuilders.com 181081 client transfer prohibited abuse@web.com 2029-11-06 not checked whois | google
rockieslaw.com 452934 client transfer prohibited abuse@web.com 2029-11-05 not checked whois | google
klgfitness.com 274503 client transfer prohibited abuse@godaddy.com 2029-11-05 not checked whois | google
clarabridge-c3.com 387315 client transfer prohibited abuse@godaddy.com 2029-11-05 not checked whois | google
ohioautoimports.com 209561 ok 2029-11-05 not checked whois | google
solayapp.com 238551 client transfer prohibited abuse@godaddy.com 2029-11-05 not checked whois | google
scribbleartworkshop.com 492918 client transfer prohibited abuse@godaddy.com 2029-11-05 not checked whois | google
cresseyco.com 145274 client transfer prohibited abuse@godaddy.com 2029-11-05 1 year ago whois | google
gurpilsan.com 758137 client transfer prohibited abuse@godaddy.com 2029-11-05 not checked whois | google
rutaalmar.com 301979 client transfer prohibited abuse@web.com 2029-11-05 not checked whois | google
mcpalacehotel.com 486031 client transfer prohibited abuse@godaddy.com 2029-11-05 not checked whois | google
nasuhhukuk.com 746956 ok abuse@nicproxy.com 2029-11-05 not checked whois | google
emetworks.com 566723 client transfer prohibited abuse@dotarai.co.th 2029-11-05 not checked whois | google
vefoitp.com 3896 client transfer prohibited abuse@namesilo.com 2029-11-05 not checked whois | google
onerehabthailand.com 388951 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-05 not checked whois | google
customhose.com 251254 client transfer prohibited abuse@web.com 2029-11-05 not checked whois | google
krskforum.com 370250 ok 2029-11-05 not checked whois | google
ianice.com 521546 client transfer prohibited abuse@godaddy.com 2029-11-04 not checked whois | google
potatojs.com 262394 ok 2029-11-04 not checked whois | google
ampmedicalphysics.com 631894 client transfer prohibited abuse@web.com 2029-11-04 not checked whois | google
homesteadmaterialshandling.com 260196 client transfer prohibited abuse@godaddy.com 2029-11-04 not checked whois | google
advancedengineeringmfg.com 399282 client transfer prohibited abuse@web.com 2029-11-04 not checked whois | google
supercharge.com 342092 client transfer prohibited abuse@uniregistry.com 2029-11-04 not checked whois | google
asmitapatel.com 274676 client transfer prohibited abuse@godaddy.com 2029-11-04 not checked whois | google
cheyennemease.com - client transfer prohibited abuse@godaddy.com 2029-11-04 11 months ago whois | google
fujifilm-houseofphotography.com 636353 ok 2029-11-04 not checked whois | google
armourcoat.com 491942 client transfer prohibited abuse@godaddy.com 2029-11-04 1 year ago whois | google
agrawalstones.com 364571 client transfer prohibited abuse@godaddy.com 2029-11-04 not checked whois | google
happychristmastoyou.com 249643 client transfer prohibited abuse@web.com 2029-11-04 not checked whois | google
kingleetech.com 404551 client transfer prohibited abuse@web.com 2029-11-04 not checked whois | google
admiraltravels.com 420089 client transfer prohibited abuse@web.com 2029-11-03 not checked whois | google
jpcottonmills.com 512095 client transfer prohibited abuse@godaddy.com 2029-11-03 not checked whois | google
stallion.com 357736 client transfer prohibited abuse@uniregistry.com 2029-11-03 not checked whois | google
admcpa.com 382221 client transfer prohibited abuse@web.com 2029-11-03 not checked whois | google
ak-comics.com 480929 client transfer prohibited abuse@web.com 2029-11-02 not checked whois | google
asiatodayaz.com 253115 client transfer prohibited abuse@godaddy.com 2029-11-02 1 year ago whois | google
thedcube.com 168928 client transfer prohibited abuse@godaddy.com 2029-11-02 not checked whois | google
phoboba.com 478361 client transfer prohibited abuse@namecheap.com 2029-11-02 not checked whois | google
myduronto.com 398601 client transfer prohibited teamabuse@innovadeus.com 2029-11-02 not checked whois | google
poppyzone.com 300605 client transfer prohibited 2029-11-02 not checked whois | google
colonycovecivicassociation.com 487171 client transfer prohibited abuse@web.com 2029-11-02 not checked whois | google
sunbirdsnacks.com 440194 client transfer prohibited abuse@web.com 2029-11-02 not checked whois | google
interiorbuildersgroup.com 514531 client transfer prohibited abuse@web.com 2029-11-01 not checked whois | google
wamolinavuc.com 258357 client transfer prohibited abuse@godaddy.com 2029-11-01 not checked whois | google
retirementandcareercoaching.com 523618 client transfer prohibited abuse@web.com 2029-11-01 not checked whois | google
arkadservices.com 732617 client transfer prohibited abuse@godaddy.com 2029-11-01 not checked whois | google
vishrutreddi.com - client transfer prohibited abuse@godaddy.com 2029-11-01 1 year ago whois | google
youkelime.com 559025 ok abuse@nicproxy.com 2029-11-01 not checked whois | google
kedewater.com 320894 ok DomainAbuse@service.aliyun.com 2029-11-01 not checked whois | google
summityukon.com 527975 client transfer prohibited abuse@namecheap.com 2029-11-01 not checked whois | google
stella-hk.com 348479 client transfer prohibited abuse@web.com 2029-11-01 not checked whois | google
davidtanphoto.com 153595 client transfer prohibited abuse@godaddy.com 2029-11-01 not checked whois | google
sherwoodglendesmoines.com 291129 client transfer prohibited abuse@web.com 2029-10-31 not checked whois | google
simplyrfid.com 352661 client transfer prohibited registrar-abuse@google.com 2029-10-31 not checked whois | google
mangaoz.com 597397 client transfer prohibited registrar-abuse@google.com 2029-10-31 not checked whois | google
harapanmasa.com 496239 client transfer prohibited abuse@godaddy.com 2029-10-31 not checked whois | google
myeemba.com 331779 client transfer prohibited abuse@godaddy.com 2029-10-31 not checked whois | google
dubbbosphorus.com 676102 ok abuse@nicproxy.com 2029-10-31 not checked whois | google
egyptvisitors.com 441760 client transfer prohibited abuse@godaddy.com 2029-10-31 not checked whois | google
mycelectric.com 283002 client transfer prohibited compliance_abuse@webnic.cc 2029-10-31 not checked whois | google
reikihealinginstitutes.com 499358 client transfer prohibited abuse@godaddy.com 2029-10-31 not checked whois | google
usedprintingmachine-sepl.com 351446 client transfer prohibited abuse@godaddy.com 2029-10-31 not checked whois | google
multiactivitytower.com 143449 client transfer prohibited abuse@godaddy.com 2029-10-31 not checked whois | google
asporus.com 303294 client transfer prohibited abuse@godaddy.com 2029-10-31 not checked whois | google
techfirm.com 244011 client transfer prohibited abuse@web.com 2029-10-31 not checked whois | google
netoc.com 373692 client transfer prohibited abuse@web.com 2029-10-31 not checked whois | google
hargray.com 131407 client transfer prohibited abuse@spiritdomains.com 2029-10-31 not checked whois | google
mbrochester.com 308632 client transfer prohibited abuse@web.com 2029-10-31 not checked whois | google
dawnwesterberg.com 777274 client transfer prohibited abuse@godaddy.com 2029-10-30 not checked whois | google
citizennewspapergroup.com 289228 client transfer prohibited abuse@godaddy.com 2029-10-30 not checked whois | google
mashrabechisht.com 239828 client transfer prohibited abuse@godaddy.com 2029-10-30 not checked whois | google
hickeysfuneralhome.com 309947 client transfer prohibited abuse@godaddy.com 2029-10-30 not checked whois | google
balkaneloksal.com 746549 client transfer prohibited abuse@godaddy.com 2029-10-30 not checked whois | google
tritechretail.com 424583 client transfer prohibited abuse@web.com 2029-10-30 not checked whois | google
frodexim.com 219337 client transfer prohibited 2029-10-30 not checked whois | google
thailand-reviews.com 514848 client transfer prohibited 2029-10-30 not checked whois | google
adhritjha.com 442886 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-10-30 not checked whois | google
doguscollection.com 594594 ok abuse@nicproxy.com 2029-10-30 not checked whois | google
harishbakery.com 274393 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-10-30 1 year ago whois | google
tomorrow-island.com 603691 client transfer prohibited abuse@godaddy.com 2029-10-30 not checked whois | google
legalvideo.com 520039 client transfer prohibited abuse@web.com 2029-10-30 not checked whois | google
medrecruiters.com 294692 client transfer prohibited abuse@web.com 2029-10-30 not checked whois | google
honducargo.com 568865 client transfer prohibited 2029-10-30 not checked whois | google
caytsmeatsandmeals.com 229296 client transfer prohibited abuse@godaddy.com 2029-10-30 not checked whois | google
businessdirectre.com 109064 client transfer prohibited abuse@wildwestdomains.com 2029-10-29 not checked whois | google
ezoiccdn.com 434541 client transfer prohibited 2029-10-29 not checked whois | google
crossurns.com 468159 client transfer prohibited abuse@web.com 2029-10-29 not checked whois | google
scottishgroupcompanies.com 490220 client transfer prohibited abuse@godaddy.com 2029-10-29