search in name
search #2 in name
whois status
whois email
min rank
- max rank
max records
chars
registration availability

SELECT * FROM domains WHERE domain_id > 0 AND domain_whois_expiration_date >0 ORDER BY domain_whois_expiration_date desc LIMIT 500
Query time: 0.03 sec

500 results

fav domain rank whois status email whois expiration avail avail date tools
cuyahogacounty.us 75452 ok espies@cuyahogacounty.us 2038-01-19 3 years ago whois
thesandboxchicago.com 320702 client transfer prohibited 2029-12-12 not checked whois
gigfasteruniversity.com 136788 client transfer prohibited abuse@godaddy.com 2029-12-12 not checked whois
gcroofing.com - client transfer prohibited abuse@godaddy.com 2029-12-12 7 months ago whois
homeover.com 352719 client transfer prohibited dns@cs.aplus.net 2029-12-11 1 year ago whois
myrtomiliou.com 453789 client transfer prohibited abuse@web.com 2029-12-10 not checked whois
pnc-qa.com 478724 client transfer prohibited domainabuse@cscglobal.com 2029-12-10 not checked whois
wottoart.com - client transfer prohibited abuse@godaddy.com 2029-12-09 1 year ago whois
roseacredental.com 772261 client transfer prohibited abuse@web.com 2029-12-09 not checked whois
mdgamerica.com 486136 client transfer prohibited abuse@web.com 2029-12-08 not checked whois
farmingtonlittleleague.com 365743 client transfer prohibited abuse@godaddy.com 2029-12-08 not checked whois
sturgeonventures.com 685412 client transfer prohibited 2029-12-07 not checked whois
tranetechnologies.com 396443 ok 2029-12-06 not checked whois
play88go.com 227130 client transfer prohibited compliance_abuse@webnic.cc 2029-12-06 not checked whois
masters-school.com 259691 client transfer prohibited abuse@web.com 2029-12-06 not checked whois
lerelaisdumiel.com - client transfer prohibited abuse-registrar@nordnet.net 2029-12-06 1 year ago whois
rmram.com 346597 client transfer prohibited abuse@godaddy.com 2029-12-05 not checked whois
ace4surplus.com 472238 client transfer prohibited abuse@web.com 2029-12-04 not checked whois
weilongzhang.com 529028 client transfer prohibited abuse@web.com 2029-12-04 not checked whois
globalhtf.com 705950 client transfer prohibited 2029-12-04 1 year ago whois
7e.com 538070 client transfer prohibited abuse@web.com 2029-12-04 not checked whois
latcrosswordanswers.com 259828 client transfer prohibited abuse@namecheap.com 2029-12-04 not checked whois
vixo.com - client transfer prohibited 2029-12-03 1 year ago whois
onestopcustom.com - ok 2029-12-02 10 months ago whois
wayneandersbeachagent.com 500594 client transfer prohibited abuse@web.com 2029-12-02 not checked whois
orlandohotyoga.com 236319 client transfer prohibited abuse@godaddy.com 2029-12-02 not checked whois
bisorun.com 658667 ok abuse@domaintime.biz 2029-12-02 not checked whois
blackdogtherapy.com - client transfer prohibited abuse@register.it 2029-12-02 7 months ago whois
socksstores.com 665306 ok abuse@nicproxy.com 2029-12-02 not checked whois
osesemi.com - client transfer prohibited supervision@xinnet.com 2029-12-02 1 year ago whois
ivonnehernandez.com 229212 client transfer prohibited abuse@namejuice.com 2029-12-01 not checked whois
muytacos.com 758516 client transfer prohibited abuse@web.com 2029-12-01 not checked whois
dobuya.com - ok abuse@55hl.com 2029-12-01 9 months ago whois
airservicesaustralia.com 142557 client transfer prohibited abuse@melbourneit.com.au 2029-12-01 not checked whois
yuadon.com - client transfer prohibited DomainAbuse@service.aliyun.com 2029-12-01 3 years ago whois
locksdaily.com 299318 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-12-01 not checked whois
hirdavolt.com 480953 client transfer prohibited 2029-11-30 not checked whois
onetravel-eg.com 569621 client transfer prohibited abuse@namecheap.com 2029-11-29 not checked whois
outletdogoleiro.com 538272 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-29 1 year ago whois
namsanambalaj.com 643672 client transfer prohibited 2029-11-29 not checked whois
bouiblane.com 231706 client transfer prohibited abuse@namecheap.com 2029-11-28 not checked whois
wildanimalexpeditions.com 510387 client transfer prohibited abuse@domainit.com 2029-11-28 not checked whois
zmncollection.com 596424 client transfer prohibited 2029-11-27 not checked whois
notforcreatives.com 505046 client transfer prohibited abuse@godaddy.com 2029-11-27 not checked whois
ngfeeds.com - client transfer prohibited abuse@godaddy.com 2029-11-27 12 months ago whois
johnscateringny.com 364044 client transfer prohibited abuse@godaddy.com 2029-11-26 not checked whois
blackwolfrental.com 361450 client transfer prohibited abuse@godaddy.com 2029-11-26 not checked whois
hediyenizvar.com 716244 client transfer prohibited abuse@godaddy.com 2029-11-26 not checked whois
oltayagel.com 740849 ok 2029-11-26 1 year ago whois
techstrait.com 496764 client transfer prohibited abuse@web.com 2029-11-26 not checked whois
mountauburndental.com 459381 client transfer prohibited abuse@godaddy.com 2029-11-25 not checked whois
havintextile.com 609604 client transfer prohibited abuse@onlinenic.com 2029-11-25 not checked whois
thesalesgroup.com 297334 client transfer prohibited abuse@web.com 2029-11-25 not checked whois
steelwings.com 213174 client transfer prohibited abuse@web.com 2029-11-25 not checked whois
minterdial.com 240046 client transfer prohibited abuse@godaddy.com 2029-11-24 1 year ago whois
silvasfinancialservices.com 288935 client transfer prohibited abuse@godaddy.com 2029-11-24 not checked whois
lovecrafttattoo.com - ok 2029-11-24 1 year ago whois
mbifinancial.com 284460 client transfer prohibited abuse@webnames.ca 2029-11-24 not checked whois
hmadesign.com 503665 client transfer prohibited compliance_abuse@webnic.cc 2029-11-24 1 year ago whois
coexgroup.com 586497 client transfer prohibited abuse@web.com 2029-11-24 not checked whois
marcovi.com 534083 client transfer prohibited abuse@web.com 2029-11-23 not checked whois
gigamonkeys.com 546405 client transfer prohibited abuse@namecheap.com 2029-11-23 not checked whois
catroullette.com 268717 client transfer prohibited abuse@godaddy.com 2029-11-22 not checked whois
apohair.com 476239 client transfer prohibited abuse@matbao.com 2029-11-22 10 months ago whois
stuartweb.com 241529 client transfer prohibited abuse@web.com 2029-11-22 not checked whois
fadesquares.com 154517 client transfer prohibited abuse@godaddy.com 2029-11-22 not checked whois
pefbazaar.com 574116 client transfer prohibited abuse@namecheap.com 2029-11-21 not checked whois
gideonhvac.com 113028 client transfer prohibited abuse@godaddy.com 2029-11-21 not checked whois
idealpak.com 568879 ok DomainAbuse@service.aliyun.com 2029-11-21 not checked whois
doplan.com 337939 client transfer prohibited abuse@web.com 2029-11-21 not checked whois
roseandassociates.com 265012 client transfer prohibited abuse@web.com 2029-11-20 not checked whois
fairman-consulting.com - client transfer prohibited abuse@bookmyname.com 2029-11-20 11 months ago whois
echamat-kernst.com - ok abuse-registrar@nordnet.net 2029-11-20 11 months ago whois
mayhai.com 373553 client transfer prohibited abuse@pavietnam.vn 2029-11-20 not checked whois
trcustominc.com 437811 client transfer prohibited abuse@godaddy.com 2029-11-20 not checked whois
nickbarber.com - client transfer prohibited registrar-abuse@google.com 2029-11-20 9 months ago whois
seankcollinslaw.com 190457 client transfer prohibited abuse@godaddy.com 2029-11-19 not checked whois
tayfx.com 428822 ok abuse@nicproxy.com 2029-11-19 not checked whois
zelorie.com 416440 client transfer prohibited abuse@godaddy.com 2029-11-19 not checked whois
cognitivebehaviouralcoachingworks.com 220468 client transfer prohibited 2029-11-19 1 year ago whois
olvin.com 430782 client transfer prohibited abuse@godaddy.com 2029-11-19 1 year ago whois
criminaldefenselawyervirginia.com 698113 client transfer prohibited abuse@godaddy.com 2029-11-18 not checked whois
jhaladjian.com 559931 client transfer prohibited abuse@godaddy.com 2029-11-18 not checked whois
ndegenkolb.com 520524 client transfer prohibited abuse@godaddy.com 2029-11-18 not checked whois
pk-research.com 519240 client transfer prohibited abuse@web.com 2029-11-18 not checked whois
alhambrapalacechicago.com 312759 client transfer prohibited abuse@godaddy.com 2029-11-17 not checked whois
gobeyondbones.com 611723 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-17 not checked whois
yatko.com 366915 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-16 1 year ago whois
glicklaw.com 461824 client transfer prohibited abuse@web.com 2029-11-16 not checked whois
kordeaux.com 317618 client transfer prohibited abuse@namesilo.com 2029-11-15 not checked whois
fabiofischer.com 618177 ok abuse@nicproxy.com 2029-11-15 not checked whois
kogans.com 342414 client transfer prohibited abuse@web.com 2029-11-15 not checked whois
guitar-stool.com - client transfer prohibited 2029-11-15 11 months ago whois
cybertrk.com 560844 client transfer prohibited abuse@godaddy.com 2029-11-14 not checked whois
hotelprincipadodurango.com - ok abuse-contact@publicdomainregistry.com 2029-11-14 8 months ago whois
iqwings.com - client transfer prohibited abuse@godaddy.com 2029-11-14 1 year ago whois
transporteknotfest.com 354105 client transfer prohibited 2029-11-13 not checked whois
studentsprinting.com 327356 client transfer prohibited abuse@godaddy.com 2029-11-13 not checked whois
ijmtoyota.com 480878 client transfer prohibited abuse@godaddy.com 2029-11-13 not checked whois
skheme.com 449703 client transfer prohibited abuse@melbourneit.com.au 2029-11-12 10 months ago whois
endurancebin.com 362800 client transfer prohibited 2029-11-12 11 months ago whois
balonagahi.com 315547 ok 2029-11-12 not checked whois
odevzamani.com 607087 ok abuse@domaintime.biz 2029-11-12 not checked whois
gooseriverbank.com - client transfer prohibited abuse@godaddy.com 2029-11-12 1 year ago whois
worthlessafc.com 515595 client transfer prohibited abuse@web.com 2029-11-11 not checked whois
srglobalmy.com 566446 client transfer prohibited abuse@godaddy.com 2029-11-11 not checked whois
srglobalus.com 241387 client transfer prohibited abuse@godaddy.com 2029-11-11 not checked whois
wailuarivernoni.com 294568 client transfer prohibited abuse@godaddy.com 2029-11-11 not checked whois
actschb.com 744803 client transfer prohibited abuse@web.com 2029-11-10 not checked whois
orangecountytranslations.com 271310 client transfer prohibited abuse@namecheap.com 2029-11-10 not checked whois
zackcotton.com 511301 client transfer prohibited abuse@namecheap.com 2029-11-10 not checked whois
nmanikiran.com 487465 client transfer prohibited abuse@porkbun.com 2029-11-10 not checked whois
lhlacy.com 500455 client transfer prohibited abuse@web.com 2029-11-10 not checked whois
huynhphuchuy.com 466737 client transfer prohibited abuse@godaddy.com 2029-11-10 not checked whois
compuproof.com 444564 ok dns@cs.aplus.net 2029-11-09 not checked whois
conleyandpartners.com 274195 client transfer prohibited abuse@godaddy.com 2029-11-09 not checked whois
ozturkfashion.com 716505 client transfer prohibited abuse@namecheap.com 2029-11-09 not checked whois
greenfieldmortgages.com 415256 ok 2029-11-09 not checked whois
sejoursanglaisenormandie.com 440952 client transfer prohibited 2029-11-09 not checked whois
kenlockqhranch.com 319373 ok abuse@crazydomains.com 2029-11-09 not checked whois
2share.com 539663 client transfer prohibited abuse@web.com 2029-11-09 not checked whois
bondedtransportation.com 359836 client transfer prohibited abuse@web.com 2029-11-08 not checked whois
ejristos.com 441165 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-08 not checked whois
greenhilljewelers.com 330571 client transfer prohibited abuse@web.com 2029-11-08 not checked whois
smtkait.com 154180 ok DomainAbuse@service.aliyun.com 2029-11-08 not checked whois
robotzone.com 532807 client transfer prohibited abuse@web.com 2029-11-08 not checked whois
appliancegenie.com 688495 client transfer prohibited 2029-11-07 not checked whois
wecre8websites.com 336528 client transfer prohibited abuse@namecheap.com 2029-11-07 not checked whois
delawareshoreproperties.com 326749 client transfer prohibited abuse@web.com 2029-11-07 not checked whois
aavularealestate.com 473068 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-07 not checked whois
boyetteanimalhospital.com 184904 client transfer prohibited abuse@web.com 2029-11-07 not checked whois
reelmensucat.com 342715 client transfer prohibited 2029-11-07 not checked whois
firebird-group.com 543524 client transfer prohibited abuse@godaddy.com 2029-11-07 not checked whois
jonathanrenshon.com 758055 client transfer prohibited abuse@godaddy.com 2029-11-07 not checked whois
roeserhomes.com - client transfer prohibited abuse@melbourneit.com.au 2029-11-06 10 months ago whois
seyhangold.com 707245 client transfer prohibited abuse@godaddy.com 2029-11-06 not checked whois
shubhadish.com 491110 client transfer prohibited abuse@godaddy.com 2029-11-06 not checked whois
klgfitness.com 285891 client transfer prohibited abuse@godaddy.com 2029-11-05 not checked whois
scribbleartworkshop.com 492918 client transfer prohibited abuse@godaddy.com 2029-11-05 not checked whois
cresseyco.com 145274 client transfer prohibited abuse@godaddy.com 2029-11-05 1 year ago whois
gurpilsan.com 676135 client transfer prohibited abuse@godaddy.com 2029-11-05 not checked whois
rutaalmar.com 439275 client transfer prohibited abuse@web.com 2029-11-05 not checked whois
nasuhhukuk.com 739917 ok abuse@nicproxy.com 2029-11-05 not checked whois
onerehabthailand.com 557179 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-11-05 not checked whois
customhose.com 224685 client transfer prohibited abuse@web.com 2029-11-05 not checked whois
krskforum.com 439921 ok 2029-11-05 not checked whois
potatojs.com 262394 ok 2029-11-04 not checked whois
advancedengineeringmfg.com 399282 client transfer prohibited abuse@web.com 2029-11-04 not checked whois
supercharge.com 337165 client transfer prohibited abuse@uniregistry.com 2029-11-04 not checked whois
fujifilm-houseofphotography.com 119865 ok 2029-11-04 not checked whois
armourcoat.com 129475 client transfer prohibited abuse@godaddy.com 2029-11-04 1 year ago whois
agrawalstones.com 480666 client transfer prohibited abuse@godaddy.com 2029-11-04 not checked whois
kingleetech.com 663718 client transfer prohibited abuse@web.com 2029-11-04 not checked whois
jpcottonmills.com 512095 client transfer prohibited abuse@godaddy.com 2029-11-03 not checked whois
stallion.com 357736 client transfer prohibited abuse@uniregistry.com 2029-11-03 not checked whois
admcpa.com 351064 client transfer prohibited abuse@web.com 2029-11-03 not checked whois
ak-comics.com 480929 client transfer prohibited abuse@web.com 2029-11-02 not checked whois
asiatodayaz.com 253115 client transfer prohibited abuse@godaddy.com 2029-11-02 1 year ago whois
phoboba.com 478361 client transfer prohibited abuse@namecheap.com 2029-11-02 not checked whois
colonycovecivicassociation.com 487171 client transfer prohibited abuse@web.com 2029-11-02 not checked whois
sunbirdsnacks.com 440194 client transfer prohibited abuse@web.com 2029-11-02 not checked whois
interiorbuildersgroup.com 514531 client transfer prohibited abuse@web.com 2029-11-01 not checked whois
retirementandcareercoaching.com 523618 client transfer prohibited abuse@web.com 2029-11-01 not checked whois
vishrutreddi.com - client transfer prohibited abuse@godaddy.com 2029-11-01 12 months ago whois
kedewater.com 320894 ok DomainAbuse@service.aliyun.com 2029-11-01 not checked whois
summityukon.com 527975 client transfer prohibited abuse@namecheap.com 2029-11-01 not checked whois
davidtanphoto.com 153595 client transfer prohibited abuse@godaddy.com 2029-11-01 not checked whois
simplyrfid.com 391731 client transfer prohibited registrar-abuse@google.com 2029-10-31 not checked whois
mangaoz.com 597397 client transfer prohibited registrar-abuse@google.com 2029-10-31 not checked whois
myeemba.com 331779 client transfer prohibited abuse@godaddy.com 2029-10-31 not checked whois
dubbbosphorus.com 606302 ok abuse@nicproxy.com 2029-10-31 not checked whois
egyptvisitors.com 441760 client transfer prohibited abuse@godaddy.com 2029-10-31 not checked whois
mycelectric.com 204215 client transfer prohibited compliance_abuse@webnic.cc 2029-10-31 not checked whois
multiactivitytower.com 307493 client transfer prohibited abuse@godaddy.com 2029-10-31 not checked whois
asporus.com 303294 client transfer prohibited abuse@godaddy.com 2029-10-31 not checked whois
netoc.com 373692 client transfer prohibited abuse@web.com 2029-10-31 not checked whois
hargray.com 362179 client transfer prohibited abuse@spiritdomains.com 2029-10-31 not checked whois
mashrabechisht.com 330534 client transfer prohibited abuse@godaddy.com 2029-10-30 not checked whois
balkaneloksal.com 746549 client transfer prohibited abuse@godaddy.com 2029-10-30 not checked whois
tritechretail.com 216519 client transfer prohibited abuse@web.com 2029-10-30 not checked whois
frodexim.com 219337 client transfer prohibited 2029-10-30 not checked whois
adhritjha.com 442886 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-10-30 not checked whois
doguscollection.com 732213 ok abuse@nicproxy.com 2029-10-30 not checked whois
harishbakery.com 527809 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-10-30 1 year ago whois
tomorrow-island.com 603691 client transfer prohibited abuse@godaddy.com 2029-10-30 not checked whois
legalvideo.com 520039 client transfer prohibited abuse@web.com 2029-10-30 not checked whois
medrecruiters.com 294692 client transfer prohibited abuse@web.com 2029-10-30 not checked whois
honducargo.com 568865 client transfer prohibited 2029-10-30 not checked whois
caytsmeatsandmeals.com 229296 client transfer prohibited abuse@godaddy.com 2029-10-30 not checked whois
businessdirectre.com 109064 client transfer prohibited abuse@wildwestdomains.com 2029-10-29 not checked whois
crossurns.com 468159 client transfer prohibited abuse@web.com 2029-10-29 not checked whois
scottishgroupcompanies.com 490220 client transfer prohibited abuse@godaddy.com 2029-10-29 not checked whois
kengarffperformancezone.com 190736 client transfer prohibited abuse@joker.com 2029-10-29 not checked whois
wealthinproperties.com 364045 client transfer prohibited abuse@godaddy.com 2029-10-29 not checked whois
blockchainlittlebook.com 356949 client transfer prohibited abuse@name.com 2029-10-29 not checked whois
ceomehmet.com 670770 client transfer prohibited 2029-10-29 not checked whois
cosmicyogas.com 472084 client transfer prohibited abuse@godaddy.com 2029-10-29 not checked whois
dvtokyo.com 339515 client transfer prohibited compliance_abuse@webnic.cc 2029-10-29 not checked whois
gimmgimm.com 323003 ok DomainAbuse@service.aliyun.com 2029-10-29 1 year ago whois
ketras.com 210413 client transfer prohibited abuse@web.com 2029-10-29 not checked whois
repeatertrap.com 289458 ok abuse@godaddy.com 2029-10-28 not checked whois
margehotels.com 451237 client transfer prohibited abuse@godaddy.com 2029-10-28 not checked whois
commercialpropertiesinc.com 269202 client transfer prohibited abuse@web.com 2029-10-28 not checked whois
xcmitc.com 535211 client transfer prohibited 2029-10-28 not checked whois
ugwitchcraftstore.com 450542 client transfer prohibited abuse@namecheap.com 2029-10-28 not checked whois
tricirclepavers.com 391426 client transfer prohibited abuse@web.com 2029-10-28 not checked whois
mattisinsurance.com 453970 client transfer prohibited abuse@godaddy.com 2029-10-28 not checked whois
zycarparts.com 232486 ok DomainAbuse@service.aliyun.com 2029-10-28 not checked whois
weldonmaterials.com 583966 client transfer prohibited abuse@web.com 2029-10-28 not checked whois
flagginc.com 278754 client transfer prohibited abuse@web.com 2029-10-28 not checked whois
richardthalheimer.com 243521 client transfer prohibited abuse@godaddy.com 2029-10-28 not checked whois
magicwaterinc.com 714114 client transfer prohibited abuse@web.com 2029-10-28 not checked whois
skillaris.com 263863 ok abuse@godaddy.com 2029-10-27 not checked whois
thebeerbistro.com 397730 client transfer prohibited abuse@godaddy.com 2029-10-27 not checked whois
golderinvestment.com 282333 client transfer prohibited abuse@web.com 2029-10-27 not checked whois
bahmanpour.com 324576 client transfer prohibited abuse@godaddy.com 2029-10-27 not checked whois
trailsidephysio.com 245307 client transfer prohibited abuse@melbourneit.com.au 2029-10-27 7 months ago whois
amparotaylor.com 222525 ok abuse@godaddy.com 2029-10-27 not checked whois
jmcope.com 217424 ok abuse@web.com 2029-10-27 not checked whois
pinnaclehealthchoice.com 761711 client transfer prohibited abuse@web.com 2029-10-26 not checked whois
morrisontelecom.com 517256 client transfer prohibited abuse@web.com 2029-10-26 not checked whois
ritchieschools.com 342862 client transfer prohibited abuse@wildwestdomains.com 2029-10-26 not checked whois
precisionengineering.com 356814 ok abuse@web.com 2029-10-26 not checked whois
fabtime.com 298565 client transfer prohibited abuse@web.com 2029-10-26 not checked whois
9di.com 488127 client transfer prohibited abuse@godaddy.com 2029-10-25 not checked whois
hdyoung.com 358106 client transfer prohibited abuse@web.com 2029-10-25 not checked whois
wwflooringgroup.com 257792 client transfer prohibited abuse@godaddy.com 2029-10-25 not checked whois
reemkelani.com 535106 client transfer prohibited 2029-10-25 not checked whois
gordonllp.com 253275 client transfer prohibited abuse@web.com 2029-10-25 not checked whois
un1quefootball.com 68084 client transfer prohibited abuse@godaddy.com 2029-10-25 not checked whois
technochoix.com - client transfer prohibited abuse@dynadot.com 2029-10-25 1 year ago whois
vacatiaainternational.com 305252 client transfer prohibited abuse@godaddy.com 2029-10-25 not checked whois
taterli.com 290860 ok abuse@dnspod.com 2029-10-25 not checked whois
norrgear.com 498199 client transfer prohibited abuse@godaddy.com 2029-10-25 not checked whois
dabblelab.com 460154 client transfer prohibited abuse@godaddy.com 2029-10-25 7 months ago whois
shopatculture.com 157090 client transfer prohibited abuse@godaddy.com 2029-10-25 not checked whois
melbournerendering.com 353262 ok abuse@crazydomains.com 2029-10-25 not checked whois
medzone-biotech.com 331126 client transfer prohibited 2029-10-25 not checked whois
soo666.com - client transfer prohibited abuse@dnspod.com 2029-10-25 5 months ago whois
ziemsford.com 388961 client transfer prohibited abuse@web.com 2029-10-24 not checked whois
elbetekstil.com 651816 ok 2029-10-24 not checked whois
westfeinberg.com 369454 client transfer prohibited abuse@web.com 2029-10-24 not checked whois
drjalpeshmehta.com 465756 client transfer prohibited abuse@godaddy.com 2029-10-24 not checked whois
hummusmarket.com 378127 client transfer prohibited abuse@godaddy.com 2029-10-24 not checked whois
ucuzkombim.com 605060 client transfer prohibited abuse@onlinenic.com 2029-10-24 not checked whois
mitchellogilvie.com - client transfer prohibited abuse@melbourneit.com.au 2029-10-23 10 months ago whois
eternitymemorials.com 406809 client transfer prohibited abuse@web.com 2029-10-23 not checked whois
lotuly.com 595853 client transfer prohibited abuse@namecheap.com 2029-10-23 not checked whois
vimc-shipping.com 620374 client transfer prohibited 2029-10-23 not checked whois
swinetechnologies.com 399609 client transfer prohibited abuse@godaddy.com 2029-10-23 11 months ago whois
eternitycapital.com 487665 client transfer prohibited abuse@web.com 2029-10-23 not checked whois
stocksons.com 75090 client transfer prohibited abuse@namecheap.com 2029-10-23 not checked whois
cqc.com 330418 client transfer prohibited abuse@godaddy.com 2029-10-23 1 year ago whois
edwardburkeplumbingandheating.com 351947 client transfer prohibited abuse@godaddy.com 2029-10-22 not checked whois
edisonequipment.com 333589 client transfer prohibited abuse@web.com 2029-10-22 not checked whois
ttatax.com 472826 client transfer prohibited abuse@web.com 2029-10-22 not checked whois
julianfernandez.com 361996 client transfer prohibited abuse@web.com 2029-10-22 not checked whois
georginabloomberg.com 271326 client transfer prohibited 2029-10-22 not checked whois
nanniesrivieramaya.com 236275 client transfer prohibited abuse@godaddy.com 2029-10-22 not checked whois
mrzhangl.com 693601 ok abuse@dnspod.com 2029-10-22 not checked whois
otaillaw.com 271533 client transfer prohibited abuse@godaddy.com 2029-10-22 not checked whois
amitywellness.com - client transfer prohibited abuse@wildwestdomains.com 2029-10-22 12 months ago whois
trekco.com 302747 client transfer prohibited abuse@web.com 2029-10-22 not checked whois
canadianoaks.com 570246 client transfer prohibited abuse@godaddy.com 2029-10-22 not checked whois
edwardsandsherlock.com 415572 client transfer prohibited abuse@web.com 2029-10-21 not checked whois
gibbstrucks.com 256576 client transfer prohibited abuse@web.com 2029-10-21 not checked whois
sebipay.com 135002 client transfer prohibited abuse@godaddy.com 2029-10-21 not checked whois
vernonhillsoralsurgery.com - client transfer prohibited abuse@godaddy.com 2029-10-21 1 year ago whois
orianda.com 551656 client transfer prohibited abuse@web.com 2029-10-21 not checked whois
wlbdeflaw.com 394687 client transfer prohibited abuse@web.com 2029-10-21 not checked whois
cospilot.com 396925 client transfer prohibited abuse@godaddy.com 2029-10-21 7 months ago whois
overthetop.com 381877 client transfer prohibited abuse@godaddy.com 2029-10-21 not checked whois
emilbrownlofts.com 250588 ok abuse@godaddy.com 2029-10-21 not checked whois
northiowacleaningsolutions.com 690673 client transfer prohibited abuse@godaddy.com 2029-10-20 not checked whois
protekbilisim.com 645564 client transfer prohibited abuse@godaddy.com 2029-10-20 not checked whois
avahenna.com 329117 client transfer prohibited abuse@godaddy.com 2029-10-20 not checked whois
nayyarandnayyar.com 293536 client transfer prohibited abuse@godaddy.com 2029-10-20 not checked whois
pughheating.com 392776 client transfer prohibited abuse@web.com 2029-10-19 not checked whois
homesbyjmc.com 258033 client transfer prohibited abuse@web.com 2029-10-19 not checked whois
amityinternational.com 891572 client transfer prohibited 2029-10-19 1 year ago whois
blumwatersolutions.com 171145 client transfer prohibited abuse@godaddy.com 2029-10-19 not checked whois
alwaleedhouse.com 591625 client transfer prohibited abuse@godaddy.com 2029-10-19 not checked whois
achyutashrama.com 442713 client transfer prohibited abuse@godaddy.com 2029-10-19 not checked whois
versa-track.com 161333 client transfer prohibited abuse@godaddy.com 2029-10-18 not checked whois
mirandahardwoodfloors.com 366211 client transfer prohibited abuse@godaddy.com 2029-10-18 not checked whois
kevinmancuso.com 156137 client transfer prohibited abuse@web.com 2029-10-18 not checked whois
zestapunta.com 233262 client transfer prohibited abuse@godaddy.com 2029-10-18 not checked whois
kafaratplus.com 271904 client transfer prohibited abuse@godaddy.com 2029-10-18 not checked whois
azyrahim.com 235017 client transfer prohibited registrar-abuse@google.com 2029-10-18 not checked whois
mivehbama.com 481597 ok abuse@onlinenic.com 2029-10-18 not checked whois
wgkcorp.com 86953 client transfer prohibited abuse@namecheap.com 2029-10-18 not checked whois
farleywhite.com 240388 client transfer prohibited abuse@web.com 2029-10-17 not checked whois
callitselectric.com 110198 client transfer prohibited abuse@godaddy.com 2029-10-17 not checked whois
cuiqingcai.com 43122 ok supervision@xinnet.com 2029-10-17 1 year ago whois
qvir.com - client transfer prohibited abuse@godaddy.com 2029-10-17 3 years ago whois
raserkey.com 58689 client transfer prohibited abuse@gmo.jp 2029-10-17 not checked whois
spudgun.com 296740 client transfer prohibited abuse@web.com 2029-10-17 not checked whois
sukkarlaw.com 291364 client transfer prohibited abuse@web.com 2029-10-16 not checked whois
spiritdelivery.com 508833 client transfer prohibited abuse@web.com 2029-10-16 not checked whois
irvingtongas.com 248266 client transfer prohibited abuse@web.com 2029-10-16 not checked whois
kankanindy.com 387616 client transfer prohibited abuse@godaddy.com 2029-10-16 not checked whois
fluxmobi.com 469819 client transfer prohibited abuse-contact@publicdomainregistry.com 2029-10-16 not checked whois
biochanger.com 748534 ok abuse@domaintime.biz 2029-10-16 not checked whois
divetimor.com 586289 ok abuse@web.com 2029-10-16 not checked whois
gulfoilltd.com 512781 ok 2029-10-16 not checked whois
0769jw.com 772632 ok DomainAbuse@service.aliyun.com 2029-10-16 not checked whois
brightred.com 484917 client transfer prohibited 2029-10-16 not checked whois
bajacountryclub.com 116914 client transfer prohibited abuse@godaddy.com 2029-10-15 not checked whois
wgwmortuary.com 614331 client transfer prohibited abuse@web.com 2029-10-15 not checked whois
woodburnerscatalog.com 363688 client transfer prohibited abuse@melbourneit.com.au 2029-10-15 1 year ago whois
coindu.com 130216 client transfer prohibited 2029-10-15 not checked whois
onregularinvesting.com 384221 client transfer prohibited abuse@name.com 2029-10-15 not checked whois
carolyn-porter.com 454356 client transfer prohibited abuse@web.com 2029-10-15 not checked whois
favorfashion.com 492091 client transfer prohibited abuse@godaddy.com 2029-10-15 not checked whois
saudiasecurity.com 413629 client transfer prohibited abuse@godaddy.com 2029-10-15 not checked whois
hxeros.com 74671 ok abuse@gmo.jp 2029-10-15 not checked whois
savokosic.com 553012 client transfer prohibited abuse@godaddy.com 2029-10-15 not checked whois
vivir.com 245126 client transfer prohibited 2029-10-15 not checked whois
capconbuilders.com 425835 client transfer prohibited abuse@web.com 2029-10-15 not checked whois
proworldonline.com 194810 client transfer prohibited abuse@godaddy.com 2029-10-14 not checked whois
javascripter.com 470045 client transfer prohibited abuse@web.com 2029-10-14 not checked whois
gepsmart.com 474830 ok abuse@web.com 2029-10-14 not checked whois
abdullahoglu.com 693623 ok compliance@domain-inc.net 2029-10-14 not checked whois
talent-pursuits.com 495772 ok abuse@web.com 2029-10-14 not checked whois
amgtglobal.com 583986 client transfer prohibited abuse@web.com 2029-10-14 not checked whois
peats.com 267647 client transfer prohibited abuse@web.com 2029-10-14 not checked whois
nadaone.com 288271 client transfer prohibited abuse@web.com 2029-10-13 not checked whois
elderlawportland.com 206540 client transfer prohibited abuse@godaddy.com 2029-10-13 1 year ago whois
cdvrc.com 901738 ok DomainAbuse@service.aliyun.com 2029-10-13 not checked whois
kudalkaucuk.com 648815 ok compliance@domain-inc.net 2029-10-12 not checked whois
snowwolfwear.com 235151 client transfer prohibited abuse@namesilo.com 2029-10-12 not checked whois
quirkhub.com 106329 client transfer prohibited 2029-10-12 1 year ago whois
jahanetandorosti.com 551868 client transfer prohibited abuse@joker.com 2029-10-12 not checked whois
dollar-mall.com - client transfer prohibited abuse@godaddy.com 2029-10-12 11 months ago whois
capplanllc.com 251683 client transfer prohibited abuse@web.com 2029-10-11 not checked whois